PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G263300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 330aa    MW: 37602 Da    PI: 7.3222
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G263300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.6e-182875148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT eEd+ l++++  +G g+W++ ar+ g++Rt+k+c++rw++yl
  Aqcoe2G263300.1.p 28 RGPWTVEEDLTLINYISNHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 75
                       89********************************************97 PP

2Myb_DNA-binding51.22.8e-1681124146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Aqcoe2G263300.1.p  81 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 124
                        7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8642375IPR017930Myb domain
SuperFamilySSF466891.05E-3025122IPR009057Homeodomain-like
SMARTSM007174.5E-152777IPR001005SANT/Myb domain
PfamPF002491.2E-162875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-232982IPR009057Homeodomain-like
CDDcd001675.42E-113075No hitNo description
PROSITE profilePS5129423.24676130IPR017930Myb domain
SMARTSM007171.3E-1480128IPR001005SANT/Myb domain
PfamPF002495.7E-1581124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-2383129IPR009057Homeodomain-like
CDDcd001676.96E-7101124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MDINVRGCSS SSSATTQSDV EDSLDLRRGP WTVEEDLTLI NYISNHGEGR WNSLARCAGL  60
KRTGKSCRLR WLNYLRPDVR RGNITLEEQL LILELHSRWG NRWSKIAQHL PGRTDNEIKN  120
YWRTRVQKHA KQLKCDVNSK QFKDTMRYLW MPRLVERIQA AAATSSASGS NTTTTTTTSH  180
HHLYNNNNNS NSSYNNNNSS NNSSYNNQEL TTATQILPVG RGAFINSSFT PENSSTGASS  240
DSMASDMRDY YTFQANNNNY QNTQNAHMNY PDSQTNLSGY FNQELAYQGS DQHQQQQNNM  300
WFGGGEDIVE NSWNVEDLWF LQQQLMHGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-252512224120MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00334DAPTransfer from AT3G06490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270853.11e-122PREDICTED: transcription factor MYB108
SwissprotQ9LDE14e-90MY108_ARATH; Transcription factor MYB108
TrEMBLB9HX621e-120B9HX62_POPTR; Uncharacterized protein
STRINGPOPTR_0010s15970.11e-120(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.14e-85myb domain protein 78